Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003030.1_g00004.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 262aa    MW: 30000.1 Da    PI: 8.2749
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003030.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                      NAM  14 lvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkdkevlskk 96 
                              lvv+yL++kv++k++++ e+i+ vdiyk+ePw+L++  +v+++++ewyf +  +kky+ ++  n+ +t++gyWk++ kd++v + k
                              99***************.89**************94457888999************9877788879***************99.8 PP

                      NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                              +e vg+kktLv++ g+ p+g++t+Wvmheyrl
  Itr_sc003030.1_g00004.1  90 REIVGMKKTLVYHAGKPPNGRRTNWVMHEYRL 121
                              999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100539.0591145IPR003441NAC domain
SuperFamilySSF1019413.66E-396145IPR003441NAC domain
PfamPF023651.1E-166121IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-26614630166NAC domain-containing protein 19
4dul_A1e-26614630166NAC domain-containing protein 19
3swp_D1e-26614633169NAC domain-containing protein 19
3swp_C1e-26614633169NAC domain-containing protein 19
3swp_B1e-26614633169NAC domain-containing protein 19
3swp_A1e-26614633169NAC domain-containing protein 19
3swm_D1e-26614633169NAC domain-containing protein 19
3swm_C1e-26614633169NAC domain-containing protein 19
3swm_B1e-26614633169NAC domain-containing protein 19
3swm_A1e-26614633169NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ84K006e-51NAC78_ARATH; NAC domain-containing protein 78
STRINGBra001365.1-P2e-56(Brassica rapa)
STRINGSolyc11g008010.1.12e-56(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.19e-54NAC domain containing protein 52